Razsoul Game (2025)
- Developer
- https://x.com/Razsoulwow, https://www.twitch.tv/razsoul, https://www.youtube.com/@jamesyoung4558, https://www.tiktok.com/@razsoulwow, https://www.instagram.com/razsoulwow/
- Publisher
- https://x.com/Razsoulwow
- Platforms
- Windows
- Genres
- Action, Adventure, Casual, Indie
- Where to get it
- Steam
How it feels
A fast-paced, side-scrolling platformer with escalating challenge as you navigate vibrant levels, use power-ups to fly and shoot fireballs, and face epic boss battles.
action-packedside-scrollingchallengingfast-paceddynamicvibrantdifficulty variants
More games like this
- RazePact (2025)
- Gudetamarun: Running Gudetama! But Gudetama wants to be Gudegude (2025)
- Final Formation (2025)
- WildWorlds: Zyxaranth's Domain (2025)
- Super Miners (2025)
- Get Rich Quick (2025)
- Crystal Gaiden Origins (2025)
- Roughhouzzers (2025)
This page is from Underplayed Gems, a catalog of older and overlooked games. Not quite it? Tell the Catbot what you feel like playing and it picks from the whole catalog, or browse by platform and genre.