Underplayed Gems
The whole movie catalogue

Films and series, searchable by what they are

← Back to the shop

The Cocoanuts (1929)

The Cocoanuts poster
Directed by
Robert Florey, Joseph Santley
Genre
comedy film, musical film
Country
United States
Runtime
1h 33m
Rated
NR
Rating
6.5 of 10 from 125 voters
Elsewhere
IMDb

How it feels

The Marx Brothers run a hotel in Florida during a real estate boom. They get involved in romantic mix-ups and a jewel theft.

comediclivelyfast-pacedwhimsicalmusicalcampyenergeticzany

What happens

The Cocoanuts is a 1929 pre-Code musical comedy film starring the Marx Brothers (Groucho, Harpo, Chico, and Zeppo). Produced for Paramount Pictures by Walter Wanger, who is not credited, the film also stars Mary Eaton, Oscar Shaw, Margaret Dumont and Kay Francis. The first sound film to credit more than one director (Robert Florey and Joseph Santley), it was adapted to the screen by Morrie Ryskind from the musical play by George S. Kaufman. Five of the film's tunes were composed by Irving Berlin, including "When My Dreams Come True", sung by Oscar Shaw and Mary Eaton. On January 1, 2025, The Cocoanuts entered the public domain. (from Wikipedia, CC BY-SA)

Trailer

More like this

This page is from Underplayed Gems. Not quite it? Tell the Catbot what you feel like watching and it picks from the whole catalogue, or browse by genre, country and year.

Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers

Loading movies…

What should I watch?