The Cocoanuts (1929)

- Directed by
- Robert Florey, Joseph Santley
- Genre
- comedy film, musical film
- Country
- United States
- Runtime
- 1h 33m
- Rated
- NR
- Rating
- 6.5 of 10 from 125 voters
- Elsewhere
- IMDb
How it feels
The Marx Brothers run a hotel in Florida during a real estate boom. They get involved in romantic mix-ups and a jewel theft.
comediclivelyfast-pacedwhimsicalmusicalcampyenergeticzany
What happens
The Cocoanuts is a 1929 pre-Code musical comedy film starring the Marx Brothers (Groucho, Harpo, Chico, and Zeppo). Produced for Paramount Pictures by Walter Wanger, who is not credited, the film also stars Mary Eaton, Oscar Shaw, Margaret Dumont and Kay Francis. The first sound film to credit more than one director (Robert Florey and Joseph Santley), it was adapted to the screen by Morrie Ryskind from the musical play by George S. Kaufman. Five of the film's tunes were composed by Irving Berlin, including "When My Dreams Come True", sung by Oscar Shaw and Mary Eaton. On January 1, 2025, The Cocoanuts entered the public domain. (from Wikipedia, CC BY-SA)
Trailer
More like this
- Animal Crackers (1930)
- A Night in Casablanca (1946)
- A Night at the Opera (1935)
- A Day at the Races (1937)
- At the Circus (1939)
- Love Happy (1950)
- The Big Store (1941)
- Sunny Side Up (1929)
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…