Bosko's Woodland Daze (1932)

Directed by

Hugh Harman

Genre

comedy, animation

Country

United States

Runtime

7 min

Rating

5.8 of 10 from 8 voters

Elsewhere

IMDb

The catalogue in 3D

The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.

More films like this

How it feels

Bosko gets into a series of silly mishaps in the woods. It is a short cartoon from the early days of Looney Tunes.

zanyfast-pacedwhimsicalenergeticcomediclightheartedold-fashioned

What happens

Bosko's Woodland Daze is an American animated comedy short film directed by Hugh Harman. It is the 29th film in the Looney Tunes series featuring Bosko. It was released on December 17, 1932. It is the final 1932 cartoon distributed by Warner Bros. Pictures to remain under copyright, as it was renewed in 1961, while earlier 1932 cartoons were neglected by then-owner, Warner Bros. subsidiary Sunset Productions; it will lapse into the public domain on January 1, 2028. (from Wikipedia, CC BY-SA)

More like this

• Bosko the Drawback (1932)
• Ain't Nature Grand! (1931)
• Big Man from the North (1931)
• The Tree's Knees (1931)
• Big-Hearted Bosko (1932)
• Bosko the Lumberjack (1932)
• Bosko's Store (1932)
• Ups 'n Downs (1931)
• More like this film, on a shelf you can walk up to.It's the lit case on the top shelf.