Underplayed Gems

Shanghaied (1934)

Shanghaied poster
Directed by
Burt Gillett
Genre
animation
Country
United States
Runtime
7 min
Rated
NR
Rating
6.6 of 10 from 25 voters
Elsewhere
IMDb
The 3D catalogue: film cases on wooden shelves, with the cat sitting at the counter next to its greeting.

The catalogue in 3D

The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.

More films like this

How it feels

Mickey Mouse gets tricked onto a ship and has to deal with a tough captain and a mischievous parrot. He tries to escape while also helping Minnie Mouse who is trapped on board.

lightheartedcomedicfast-pacedwhimsicalslapstickplayfulenergeticcheerful

What happens

Mickey Mouse (originally known as Mickey Mouse Cartoons) is a series of American animated comedy short films produced by Walt Disney Productions. The series started in 1928 with Steamboat Willie with 2013's Get a Horse! being the most recent short in the series to date, otherwise taking a hiatus from 1953 to 1983. The series is notable for its innovation with sound synchronization and character animation, and also introduced well-known characters such as the titular protagonist Mickey Mouse, Minnie Mouse, Pluto and Goofy. The name "Mickey Mouse" was first used in the films' title sequences to refer specifically to the character, but was used from 1935 to 1953 to refer to the series itself, as in "Walt Disney presents a Mickey Mouse". In this sense "Mickey Mouse" was a shortened form of "a Mickey Mouse cartoon" which was used in the earliest films. Films from 1929 to 1935 which were re-released during this time also used this naming convention, but it was not used for the three shorts released between 1983 and 1995 (Mickey's Christmas Carol, The Prince and the Pauper, and Runaway Brain). Mickey's name was also used occasionally to market other films which were formally part of other series. Examples of this include several Silly Symphonies and Goofy and Wilbur (1939). The shorts released before 1931 are currently in the public domain. (from Wikipedia, CC BY-SA)

More like this

This page is from Underplayed Gems. Not quite it? You can browse by genre, country and year, or take this one into the 3D catalogue and ask the Catbot for something closer.