Underplayed Gems
The whole movie catalogue

Films and series, searchable by what they are

← Back to the shop

Alpine Climbers (1936)

Alpine Climbers poster
Directed by
David Hand
Genre
animation, comedy
Country
United States
Runtime
9 min
Rated
NR
Rating
6.5 of 10 from 58 voters
Elsewhere
IMDb

How it feels

Mickey Mouse, Donald Duck, and Pluto attempt to climb a mountain. They face various obstacles and comedic troubles along the way.

playfullightheartedslapstickbouncywhimsicalfast-pacedenergeticmischievous

What happens

Alpine Climbers is a 1936 American animated short film produced by Walt Disney Productions and released by United Artists. The cartoon follows Mickey Mouse, Donald Duck, and Pluto as they climb the side of a mountain. The film was directed by David Hand and includes the voices of Walt Disney as Mickey, Clarence Nash as Donald, and Lee Millar as Pluto. It was the ninth Mickey Mouse short to be released that year. As a work published in 1936 and a proper renewal notice filed within 28 years, the short will enter the American public domain in 2032. (from Wikipedia, CC BY-SA)

More like this

This page is from Underplayed Gems. Not quite it? Tell the Catbot what you feel like watching and it picks from the whole catalogue, or browse by genre, country and year.

Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers

Loading movies…

What should I watch?