Alpine Climbers (1936)

- Directed by
- David Hand
- Genre
- animation, comedy
- Country
- United States
- Runtime
- 9 min
- Rated
- NR
- Rating
- 6.5 of 10 from 58 voters
- Elsewhere
- IMDb
How it feels
Mickey Mouse, Donald Duck, and Pluto attempt to climb a mountain. They face various obstacles and comedic troubles along the way.
playfullightheartedslapstickbouncywhimsicalfast-pacedenergeticmischievous
What happens
Alpine Climbers is a 1936 American animated short film produced by Walt Disney Productions and released by United Artists. The cartoon follows Mickey Mouse, Donald Duck, and Pluto as they climb the side of a mountain. The film was directed by David Hand and includes the voices of Walt Disney as Mickey, Clarence Nash as Donald, and Lee Millar as Pluto. It was the ninth Mickey Mouse short to be released that year. As a work published in 1936 and a proper renewal notice filed within 28 years, the short will enter the American public domain in 2032. (from Wikipedia, CC BY-SA)
More like this
- A Gentleman's Gentleman (1941)
- Orphans' Picnic (1936)
- The Band Concert (1935)
- Magician Mickey (1937)
- Mickey's Elephant (1936)
- Mickey's Polo Team (1936)
- Mickey's Grand Opera (1936)
- Moose Hunters (1937)
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…