Alpine Climbers (1936)

Directed by

David Hand

Genre

animation, comedy

Country

United States

Runtime

9 min

Rated

NR

Rating

6.5 of 10 from 58 voters

Elsewhere

IMDb

The catalogue in 3D

The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.

More films like this

How it feels

Mickey Mouse, Donald Duck, and Pluto attempt to climb a mountain. They face various obstacles and comedic troubles along the way.

playfullightheartedslapstickbouncywhimsicalfast-pacedenergeticmischievous

What happens

Alpine Climbers is a 1936 American animated short film produced by Walt Disney Productions and released by United Artists. The cartoon follows Mickey Mouse, Donald Duck, and Pluto as they climb the side of a mountain. The film was directed by David Hand and includes the voices of Walt Disney as Mickey, Clarence Nash as Donald, and Lee Millar as Pluto. It was the ninth Mickey Mouse short to be released that year. As a work published in 1936 and a proper renewal notice filed within 28 years, the short will enter the American public domain in 2032. (from Wikipedia, CC BY-SA)

More like this

• A Gentleman's Gentleman (1941)
• Orphans' Picnic (1936)
• The Band Concert (1935)
• Magician Mickey (1937)
• Mickey's Elephant (1936)
• Mickey's Polo Team (1936)
• Mickey's Grand Opera (1936)
• Moose Hunters (1937)
• More like this film, on a shelf you can walk up to.It's the lit case on the top shelf.