Pluto and the Armadillo (1943)

- Directed by
- Clyde Geronimi
- Genre
- animation
- Country
- United States
- Runtime
- 7 min
- Rated
- NR
- Rating
- 6.1 of 10 from 28 voters
- Elsewhere
- IMDb

The catalogue in 3D
The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.
How it feels
Mickey Mouse goes on a small adventure with his dog Pluto and an armadillo. The short film follows their antics and interactions.
playfullightheartedwhimsicalbouncyslapstickanimatedfast-pacedcomical
What happens
Mickey Mouse (originally known as Mickey Mouse Cartoons) is a series of American animated comedy short films produced by Walt Disney Productions. The series started in 1928 with Steamboat Willie with 2013's Get a Horse! being the most recent short in the series to date, otherwise taking a hiatus from 1953 to 1983. The series is notable for its innovation with sound synchronization and character animation, and also introduced well-known characters such as the titular protagonist Mickey Mouse, Minnie Mouse, Pluto and Goofy. The name "Mickey Mouse" was first used in the films' title sequences to refer specifically to the character, but was used from 1935 to 1953 to refer to the series itself, as in "Walt Disney presents a Mickey Mouse". In this sense "Mickey Mouse" was a shortened form of "a Mickey Mouse cartoon" which was used in the earliest films. Films from 1929 to 1935 which were re-released during this time also used this naming convention, but it was not used for the three shorts released between 1983 and 1995 (Mickey's Christmas Carol, The Prince and the Pauper, and Runaway Brain). Mickey's name was also used occasionally to market other films which were formally part of other series. Examples of this include several Silly Symphonies and Goofy and Wilbur (1939). The shorts released before 1931 are currently in the public domain. (from Wikipedia, CC BY-SA)
More like this
Mickey's Pal Pluto (1933)
Playful Pluto (1934)
Plutopia (1951)
The Simple Things (1953)
Pueblo Pluto (1950)
A Gentleman's Gentleman (1941)
The Pointer (1939)
Canine Casanova (1945)- More like this film, on a shelf you can walk up to.It's the lit case on the top shelf.