Underplayed Gems
The whole movie catalogue

Films and series, searchable by what they are

← Back to the shop

Hare Ribbin' (1944)

Hare Ribbin' poster
Directed by
Bob Clampett
Genre
animation, comedy
Country
United States
Runtime
8 min
Rated
NR
Rating
6.6 of 10 from 17 voters
Elsewhere
IMDb

How it feels

Bugs Bunny tries to outsmart a red-haired hound dog with tricks and jokes. The rabbit uses disguises and reverse psychology to make the dog look foolish.

playfulfast-pacedsillywhimsicalmischievousclassic

What happens

Hare Ribbin' is a 1944 animated short film in the Merrie Melodies series, directed by Robert Clampett and featuring Bugs Bunny. The plot features Bugs' conflict with a red-haired hound dog, whom the rabbit sets out to evade and make a fool of using one-liners, reverse psychology, disguises and other tricks. It was released in theaters by Warner Bros. Pictures on June 24, 1944. The title is a pun on "hair ribbon". It is also the first Warner Bros. cartoon to include Bugs' head in the opening title sequence. (from Wikipedia, CC BY-SA)

More like this

This page is from Underplayed Gems. Not quite it? Tell the Catbot what you feel like watching and it picks from the whole catalogue, or browse by genre, country and year.

Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers

Loading movies…

What should I watch?