Hare Ribbin' (1944)

- Directed by
- Bob Clampett
- Genre
- animation, comedy
- Country
- United States
- Runtime
- 8 min
- Rated
- NR
- Rating
- 6.6 of 10 from 17 voters
- Elsewhere
- IMDb
How it feels
Bugs Bunny tries to outsmart a red-haired hound dog with tricks and jokes. The rabbit uses disguises and reverse psychology to make the dog look foolish.
playfulfast-pacedsillywhimsicalmischievousclassic
What happens
Hare Ribbin' is a 1944 animated short film in the Merrie Melodies series, directed by Robert Clampett and featuring Bugs Bunny. The plot features Bugs' conflict with a red-haired hound dog, whom the rabbit sets out to evade and make a fool of using one-liners, reverse psychology, disguises and other tricks. It was released in theaters by Warner Bros. Pictures on June 24, 1944. The title is a pun on "hair ribbon". It is also the first Warner Bros. cartoon to include Bugs' head in the opening title sequence. (from Wikipedia, CC BY-SA)
More like this
- Hare Force (1944)
- The Heckling Hare (1941)
- Hare Remover (1946)
- Stage Door Cartoon (1944)
- Rabbit's Kin (1952)
- The Grey Hounded Hare (1948)
- Foxy by Proxy (1952)
- Hare Tonic (1945)
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…