Hare Ribbin' (1944)

Directed by

Bob Clampett

Genre

animation, comedy

Country

United States

Runtime

8 min

Rated

NR

Rating

6.6 of 10 from 17 voters

Elsewhere

IMDb

The catalogue in 3D

The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.

More films like this

How it feels

Bugs Bunny tries to outsmart a red-haired hound dog with tricks and jokes. The rabbit uses disguises and reverse psychology to make the dog look foolish.

playfulfast-pacedsillywhimsicalmischievousclassic

What happens

Hare Ribbin' is a 1944 animated short film in the Merrie Melodies series, directed by Robert Clampett and featuring Bugs Bunny. The plot features Bugs' conflict with a red-haired hound dog, whom the rabbit sets out to evade and make a fool of using one-liners, reverse psychology, disguises and other tricks. It was released in theaters by Warner Bros. Pictures on June 24, 1944. The title is a pun on "hair ribbon". It is also the first Warner Bros. cartoon to include Bugs' head in the opening title sequence. (from Wikipedia, CC BY-SA)

More like this

• Hare Force (1944)
• The Heckling Hare (1941)
• Hare Remover (1946)
• Stage Door Cartoon (1944)
• Rabbit's Kin (1952)
• The Grey Hounded Hare (1948)
• Foxy by Proxy (1952)
• Hare Tonic (1945)
• More like this film, on a shelf you can walk up to.It's the lit case on the top shelf.