Trail Mix-Up (1993)

Directed by

Barry Cook

Genre

comedy film

Country

United States

Runtime

8 min

Rated

G

Rating

7.0 of 10 from 62 voters

Elsewhere

IMDb

How it feels

Roger Rabbit babysits Baby Herman while his mother is away. Cartoon chaos ensues with visual gags and slapstick humor. A live-action and animation finale shows the characters interacting with real people.

fast-pacedslapstickwhimsicalchaoticgoofycartoonishspirited

What happens

The Roger Rabbit shorts are a series of three live-action/animated short films produced by Walt Disney Feature Animation from 1989 to 1993. They feature Roger Rabbit, the animated protagonist from Who Framed Roger Rabbit (1988), being enlisted to care for Baby Herman while his mother is absent, resulting in a plot defined by slapstick humor and visual gags. Each short concludes with a sequence involving live-action and animation, in which the characters interact with live-action human beings, akin to the 1988 film. Droopy Dog from MGM makes a cameo in all of the shorts. Charles Fleischer, Kathleen Turner, Lou Hirsch, and April Winchell returned to reprise their voice roles from the film, alongside producers Steven Spielberg, Kathleen Kennedy, Frank Marshall, and Don Hahn. Marshall also directed the live-action segments in the first two shorts, while Industrial Light & Magic (ILM) was responsible for the live-action visual effects. Produced in association with Spielberg's Amblin Entertainment, the three shorts (Tummy Trouble, Roller Coaster Rabbit and Trail Mix-Up) were originally attached to the theatrical releases of several Disney and Amblin films. A fourth short, Hare in My Soup, was cancelled during pre-production, with three more (Clean and Oppressed, Beach Blanket Bay and Bronco Bustin' Bunny) in the planning stages also cancelled. Despite being produced by Walt Disney Animation, these shorts heavily contained a similar slapstick style to Warner Bros. Looney Tunes or Tex Avery cartoons, and MGM character Droopy made cameos in every one. (from Wikipedia, CC BY-SA)

More like this

• Roller Coaster Rabbit (1990)
• Tummy Trouble (1989)
• Somethin's Cookin' (1988)
• Presto (2008)
• Prest-O Change-O (1939)
• The Milky Waif (1946)
• Who's Who in the Zoo (1942)
• Sneak, Snoop and Snitch in Triple Trouble (1941)