Wielka wsypa (1993)

- Directed by
- Jan Łomnicki
- Genre
- comedy film
- Country
- Poland
- Runtime
- 1h 38m
- Rating
- 5.6 of 10 from 8 voters
- Elsewhere
- IMDb
How it feels
A Polish comedy about the rise and fall of a savings bank. It follows the fictionalized story of how this bank was created and then collapsed.
lightheartedcomicalsatiricalfast-pacedwhimsicalcaper-liketongue-in-cheek
What happens
Wielka wsypa – polska komedia sensacyjna z 1992 roku w reżyserii Jana Łomnickiego, przedstawiająca w sfabularyzowanej formie powstanie i upadek Bezpiecznej Kasy Oszczędności. Zdjęcia kręcono w Warszawie. Sequelem jest film Szczur (1995). W 2020 roku film został poddany rekonstrukcji cyfrowej i udostępniony jest na platformie 35mm.online. (from Wikipedia, CC BY-SA)
More like this
- Pajeczarki (1993)
- Goodbye Rockefeller (1993)
- Obcy musi fruwać (1993)
- The Sequence of Feelings (1993)
- Do widzenia wczoraj. Dwie krótkie komedie o zmianie systemu (1993)
- A Really Short Story about Love, Killing and Still Another Feeling (1993)
- Ene... due... like... fake... (1993)
- A Bachelor's Life Abroad (1992)
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…