Wielka wsypa (1993)

Directed by

Jan Łomnicki

Genre

comedy film

Country

Poland

Runtime

1h 38m

Rating

5.6 of 10 from 8 voters

Elsewhere

IMDb

The catalogue in 3D

The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this film is already out on the counter, with more like it waiting on the shelf next to it.

More films like this

How it feels

A Polish comedy about the rise and fall of a savings bank. It follows the fictionalized story of how this bank was created and then collapsed.

lightheartedcomicalsatiricalfast-pacedwhimsicalcaper-liketongue-in-cheek

What happens

Wielka wsypa – polska komedia sensacyjna z 1992 roku w reżyserii Jana Łomnickiego, przedstawiająca w sfabularyzowanej formie powstanie i upadek Bezpiecznej Kasy Oszczędności. Zdjęcia kręcono w Warszawie. Sequelem jest film Szczur (1995). W 2020 roku film został poddany rekonstrukcji cyfrowej i udostępniony jest na platformie 35mm.online. (from Wikipedia, CC BY-SA)

More like this

• Pajeczarki (1993)
• Goodbye Rockefeller (1993)
• Obcy musi fruwać (1993)
• The Sequence of Feelings (1993)
• Do widzenia wczoraj. Dwie krótkie komedie o zmianie systemu (1993)
• A Really Short Story about Love, Killing and Still Another Feeling (1993)
• Ene... due... like... fake... (1993)
• A Bachelor's Life Abroad (1992)
• More like this film, on a shelf you can walk up to.It's the lit case on the top shelf.