Yong Sheng 5 (2025)
- Genre
- Action, Adventure, Fantasy
The catalogue in 3D
The film shelves have a room of their own that you can walk around in. The cat behind the counter is the AI Catbot, and they pick real films from the same catalogue when you tell them what you feel like watching. Nothing is for sale, here or in there. Go in from here and this series is already out on the counter, with more like it waiting on the shelf next to it.
How it feels
In this season a young cultivator continues his journey through a fantastical martial arts world. He battles powerful enemies and unlocks ancient secrets while forging bonds with allies. The story follows his quest for strength and justice.
fast-pacedepicmythicintensevisceralsword-clashinglarger-than-life
More like this
Zhu Xian 3 (2025)
Yong Sheng: Shi Nian Zhi Yue (2023)
Wan Jie Duzun 2 (2022)
Ni Tian Jian Shen 6 (2022)
The Supreme Body Refining Master (2026)
The Legend of Sword Domain 3rd Season (2023)
Mu Shen Ji 3 (2025)
Xingchen Bian: Po Tian Mi Ju (2022)- More like this series, on a shelf you can walk up to.It's the lit case on the top shelf.
This page is from Underplayed Gems. Not quite it? You can browse by genre, country and year, or take this one into the 3D catalogue and ask the Catbot for something closer.