Yong Sheng 5 (2025)
- Genre
- Action, Adventure, Fantasy
How it feels
In this season a young cultivator continues his journey through a fantastical martial arts world. He battles powerful enemies and unlocks ancient secrets while forging bonds with allies. The story follows his quest for strength and justice.
fast-pacedepicmythicintensevisceralsword-clashinglarger-than-life
More like this
- Zhu Xian 3 (2025)
- Yong Sheng: Shi Nian Zhi Yue (2023)
- Wan Jie Duzun 2 (2022)
- Ni Tian Jian Shen 6 (2022)
- The Supreme Body Refining Master (2026)
- The Legend of Sword Domain 3rd Season (2023)
- Mu Shen Ji 3 (2025)
- Xingchen Bian: Po Tian Mi Ju (2022)
This page is from Underplayed Gems. Not quite it? Tell the Catbot what you feel like watching and it picks from the whole catalogue, or browse by genre, country and year.
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…