Underplayed Gems
The whole movie catalogue

Films and series, searchable by what they are

← Back to the shop

Mickey's Kangaroo (1935)

Mickey's Kangaroo poster
Directed by
David Hand
Genre
animation, comedy
Country
United States
Runtime
9 min
Rated
NR
Rating
5.9 of 10 from 46 voters
Elsewhere
IMDb

How it feels

Mickey Mouse receives a kangaroo as a gift. He tries to teach the kangaroo how to box and the animal causes trouble around the house.

classiclightheartedplayfulwhimsicalfast-pacedslapstickenergeticnostalgic

What happens

Mickey Mouse (originally known as Mickey Mouse Cartoons) is a series of American animated comedy short films produced by Walt Disney Productions. The series started in 1928 with Steamboat Willie with 2013's Get a Horse! being the most recent short in the series to date, otherwise taking a hiatus from 1953 to 1983. The series is notable for its innovation with sound synchronization and character animation, and also introduced well-known characters such as the titular protagonist Mickey Mouse, Minnie Mouse, Pluto and Goofy. The name "Mickey Mouse" was first used in the films' title sequences to refer specifically to the character, but was used from 1935 to 1953 to refer to the series itself, as in "Walt Disney presents a Mickey Mouse". In this sense "Mickey Mouse" was a shortened form of "a Mickey Mouse cartoon" which was used in the earliest films. Films from 1929 to 1935 which were re-released during this time also used this naming convention, but it was not used for the three shorts released between 1983 and 1995 (Mickey's Christmas Carol, The Prince and the Pauper, and Runaway Brain). Mickey's name was also used occasionally to market other films which were formally part of other series. Examples of this include several Silly Symphonies and Goofy and Wilbur (1939). The shorts released before 1931 are currently in the public domain. (from Wikipedia, CC BY-SA)

More like this

This page is from Underplayed Gems. Not quite it? Tell the Catbot what you feel like watching and it picks from the whole catalogue, or browse by genre, country and year.

Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers

Loading movies…

What should I watch?