Mickey's Kangaroo (1935)

- Directed by
- David Hand
- Genre
- animation, comedy
- Country
- United States
- Runtime
- 9 min
- Rated
- NR
- Rating
- 5.9 of 10 from 46 voters
- Elsewhere
- IMDb
How it feels
Mickey Mouse receives a kangaroo as a gift. He tries to teach the kangaroo how to box and the animal causes trouble around the house.
classiclightheartedplayfulwhimsicalfast-pacedslapstickenergeticnostalgic
What happens
Mickey Mouse (originally known as Mickey Mouse Cartoons) is a series of American animated comedy short films produced by Walt Disney Productions. The series started in 1928 with Steamboat Willie with 2013's Get a Horse! being the most recent short in the series to date, otherwise taking a hiatus from 1953 to 1983. The series is notable for its innovation with sound synchronization and character animation, and also introduced well-known characters such as the titular protagonist Mickey Mouse, Minnie Mouse, Pluto and Goofy. The name "Mickey Mouse" was first used in the films' title sequences to refer specifically to the character, but was used from 1935 to 1953 to refer to the series itself, as in "Walt Disney presents a Mickey Mouse". In this sense "Mickey Mouse" was a shortened form of "a Mickey Mouse cartoon" which was used in the earliest films. Films from 1929 to 1935 which were re-released during this time also used this naming convention, but it was not used for the three shorts released between 1983 and 1995 (Mickey's Christmas Carol, The Prince and the Pauper, and Runaway Brain). Mickey's name was also used occasionally to market other films which were formally part of other series. Examples of this include several Silly Symphonies and Goofy and Wilbur (1939). The shorts released before 1931 are currently in the public domain. (from Wikipedia, CC BY-SA)
More like this
- Mickey's Elephant (1936)
- Mickey's Man Friday (1935)
- Mickey Down Under (1948)
- The Band Concert (1935)
- Shanghaied (1934)
- Two-Gun Mickey (1934)
- Orphans' Picnic (1936)
- Cat's A-Weigh (1953)
Browse movies and series
press Enter to search by title, your filters still apply · for something by mood, tap Discover
Lists: Korean thrillers worth the evening · Anime films beyond Studio Ghibli · Slow films for a rainy night · Horror that unsettles instead of startling · Series you can finish in a weekend · Nordic crime worth the subtitles · Good films that end in under 90 minutes · Documentaries that play like thrillers
Loading movies…